#fat

11,767,914 Posts

35 seconds ago

Everything selling in an excellent price so why wait? How many of you believe in this, why not come and join our team to change your lifestyle and future. Do you want to lose weight? Do you want to look good and feel good? Who loves tea? Who loves coffee? Follow slimmingworld786 tslife launched teamwork opportunity weightlossresults weightlossjourney coffee tea resultsfitness cleanse organic babyweight detox results tea fat results halal cleanser weightlosssuccess weightlosstransformation shakes health nutritients supplement nutrition muscle

00
1 minute ago

Everything selling in an excellent price so why wait? How many of you believe in this, why not come and join our team to change your lifestyle and future. Do you want to lose weight? Do you want to look good and feel good? Who loves tea? Who loves coffee? Follow slimmingworld786 tslife launched teamwork opportunity weightlossresults weightlossjourney coffee tea resultsfitness cleanse organic babyweight detox results tea fat results halal cleanser weightlosssuccess weightlosstransformation shakes health nutritients supplement nutrition muscle

00
1 minute ago

Everything selling in an excellent price so why wait? How many of you believe in this, why not come and join our team to change your lifestyle and future. Do you want to lose weight? Do you want to look good and feel good? Who loves tea? Who loves coffee? Follow slimmingworld786 tslife launched teamwork opportunity weightlossresults weightlossjourney coffee tea resultsfitness cleanse organic babyweight detox results tea fat results halal cleanser weightlosssuccess weightlosstransformation shakes health nutritients supplement nutrition muscle

00
1 minute ago

Would you love to be Cellulite-Free? It is possible at Lavish Body Clinic with our personalised Cellulite Plans. We are the first and only Clinic here in Marbella to offer this innovative treatment combing multiple technologies which is why our machine is known as the machine with a waiting list due to the high demand for treatments. Contact us to book a free consultation 🗓 . . . . . lipofreeze fatfreezing fatreduction fat cellulitereduction coolsculpting cryolipolysis lipo marbella fatloss stubbornfat celluliteremoval marbs cellulitetreatment fatfreeze liposuction weightloss cellulite lavishbodyclinic radiofrequency cavitation bodyhifu getridofcellulite

00
1 minute ago

Everything selling in an excellent price so why wait? How many of you believe in this, why not come and join our team to change your lifestyle and future. Do you want to lose weight? Do you want to look good and feel good? Who loves tea? Who loves coffee? Follow slimmingworld786 tslife launched teamwork opportunity weightlossresults weightlossjourney coffee tea resultsfitness cleanse organic babyweight detox results tea fat results halal cleanser weightlosssuccess weightlosstransformation shakes health nutritients supplement nutrition muscle

30
1 minute ago

Everything selling in an excellent price so why wait? How many of you believe in this, why not come and join our team to change your lifestyle and future. Do you want to lose weight? Do you want to look good and feel good? Who loves tea? Who loves coffee? Follow slimmingworld786 tslife launched teamwork opportunity weightlossresults weightlossjourney coffee tea resultsfitness cleanse organic babyweight detox results tea fat results halal cleanser weightlosssuccess weightlosstransformation shakes health nutritients supplement nutrition muscle

60
2 minutes ago

~Fat Pharaoh Freeway~ -You know you’re fat...when you have to get off the Pharaoh Fwy ride at the pumpkin festival in Circleville because the bars won’t close. Lol So, you watch and take photos on the sidelines as the embarrassment slowly eats away at any pride you may have left 😵🤦🏻‍♀️...yeah, three months into my new and healthier lifestyle (completely hit “f*ck it” and gave up on life there for about 8 years.) but the weight gain can’t come off quick enough! I’m just focusing on patience...that’s the hardest part. But, I’m going to keep disciplining myself more and start living my life the best way I can. 💪😀 fairfood pumpkinfestival photographytherapy photographyislife fat fightingfat embarrassing embarrassingmoments

00
5 minutes ago

U većini slučajeva, kada patimo od gorušice, pomislimo da je u pitanju višak zeludačne kiseline. Nažalost, ovakvo mišljenje ima i većina doktora, koji će vam za ovaj problem prepisati neki od lekova za smanjenje kiseline ili, još gore, neki od “proton pump” inhibitora koji ne deluju direktno u želucu, već kroz krv dolaze do ćelija želuca i onemogućavaju ih da izluče dovoljne količine kiseline. Ovi lekovi pružaju trenutno olakšanje, ali će se problem, na duge staze, samo pogoršati. . . . . . heartburn digestion trainings breathing vezbanje bol painless stressrelief naturesperfectalchemy fat naturalhealth bodytransformations digestion savet healthadvice zdravlje healthygut zdravlje zdravo immunityboost healthytips inflamation umor tierd headaches digestivehealth acidreflux stomak healthycarbs digestionsupport

30
6 minutes ago

Lettuce be happy.

81
8 minutes ago

Everyone is consuming too much sugar, wether they realize it or not. Our bodies don’t need a lot of it, and we’re sabotaging our bodies. Swipe left to see just how many forms sugar comes in! 🍭 - If you want to be healthy, you can’t wish to be healthy. Hoping isn’t enough to change how your body regulates things. You need to actually figure out what works for your body to make it healthy, you have to do, not just think or say 🥗 - keto gym fat fitness sugar inflammation health body honey brain kidneys biology education awareness food skinny bones muscles figure

80
8 minutes ago

have I mentioned that I’m done?

41
8 minutes ago

📸iqphysique96 _ 📝 _ 👌🏼High Protein Breakfast Ideas👌🏼 . Follow roballenfitness for more fitness/nutrition info 😊 . Some great options here by my friend Hamaad from iqphysique96 😊 . A lot of people struggle to get enough protein in the day and have structured meals. While the organization of meals varies depending on what a person prefers, having a high-protein breakfast is a great way to help satiate you so you feel less hungry and have more energy through out the day. Here are some easy breakfasts you could make. Feel free to add spices, more veggies, or anything else. Just remember that you want to control your calorie intake/portion sizes for anything you eat. - - Remember that these are simply suggestions and there is no magic breakfast or inherent fat-burning properties of these meals. Simply focus on having a breakfast that is high in protein, high in fiber, and that you enjoy. Fit it into your daily allotted calorie intake and you are well on your way to losing weight while feeling less hungry. .. ___________ eatingfatproteinweightlossorganicfoodfoodsilehealthhealthynaturalloseweightweightlossfatlossoatmealcaloriesmealsandwichvegankitchendietfoodfoodfitnesschickenfastfoodbreakfasteggs

700
8 minutes ago

Repost fatpumfitness (get_repost) ・・・ FATPUM FITNESS INTERNACIONAL C.A. FATPUM FUSION STRONGERS . . SIGUENOS EN NUESTRAS REDES Y PARTICIPA POR UNA CERTIFICACION EN GUAYAQUIL ECUADOR Y CARACAS VENEZUELA (Solo debes seguir todas las cuentas a continuacion y darle like a los posts de la certificacion ) Luego escribenos por privado y el 29 De este mes se realizara el sorteo..🆗👆👆👆📋📈📊👊 Cuentas a seguir yvettgonzalezfit_coach josnellfit yusmatcyo ortiz_gena vaneneiszer aliriomoreno christian160487 supertrainergm (DISEÑO PUBLICIDAD) ninosfatpumfitness calderonfred yoberbr v_manuelbrice josyfitlife fatpumfitness_colombia . . fitnesslifestyle FATPUM FitnessForLife fitnessdecombate fitness vidasana fitnessmodel CERTIFICACIÓN gym marketingdigital likeforlikes fat hiitcardio

142
8 minutes ago

YOU HAD ONE JOB EGGS! HOLD IT TOGETHER! Eggs not all over easy *cries in nerd* got some leftovers too because gains don't care as long as they are fed! Something id like to address is gaining weight when working out, i know some people get discouraged about gaining weight and don't appreciate it for what it really means especially when you're working out hard. I may have gained a pound the past fee days but my gut is thinner and my pecs and biceps are much much firmer. Not all weight is created equal! Love you guys and remember weight is only a number! How you feel is what matters! . . . . . . . . . . . . . . . eggs ketoeggs ketofood keto ketodiet ketocheese ketobreakfast ketoweightloss ketomeal everything weightloss fatloss fat keepitup workhard notsoovereasyeggs life goals progress

70
8 minutes ago

🛒 Ingredientes: - Huevo. - Leche. - Proteína en polvo. - Canela. - Harina de avena. - Endulzante. - Claras de huevo. 📝 Preparación: - Precalentamos el horno a 160ºC. Mezclamos en un bol la leche con el huevo y el endulzante. - Agregamos la harina de avena y la proteína, la canela y volvemos a mezclar bien. - Añadimos las claras montadas e integramos con el resto de la mezcla con movimientos envolventes y suaves. - En un molde mediano de silicona, o normal cubierto de papel vegetal, verteremos nuestra mezcla. -Llevamos al horno unos 15-20 minutos y dejamos enfriar para que quede más esponjoso. Y a disfrutar con un buen vaso de leche 😋 Las cantidades de los ingredientes según vuestras necesidades. 💪⚡ 👍 DARLE LIKE 👍 🔝 yonosoytonto vidasaludable desayunofit motivation asthetics protein fat salud muscle noexcuses instafit workout

70
12 minutes ago

Sério. Cara de mal. De brabo. Mas por dentro é só amor caso vc não seja um cuzao pq aí eu fico brabo mesmo.

81
12 minutes ago

Hallöchen ihr fetten Popöchen.. Ich muss was loswerden: Der dicke Phillip steht vor der Tür! Das heißt zieht euch warm an und dann ran an den Mann mit dem Kamm und der Wammmpe in der Lampe !.!.! Ach egal fresst euch einfach voll und gönnt euch. Aber nich zu viel, sonst werdet ihr so fett wie Jessica! wampenpartysoßfatspinatwurstderdickephilippnutellaistscheißeaufbrotgönnteuchliebernudossicurlyfrieshabhuuunnggeeerrrrpsychoscreamhalloweenichhabbtwhalloweenerfundenkleinerfunfactamrandebratwurstvideoinstlolokay

62
13 minutes ago

Build muscle: Squats hit your legs hard, requiring multiple muscles to work in unison and stimulates growth. Increased strength: Squatting will strengthen your legs and the tendons in your knees like no other exercise. Improved hip mobility: The exercise builds and maintains mobility in the hip joint. fit gym gymfit gymworkout nevergiveup exercisethemind foodforthought workout workoutmotivarion mindovermatter fitinspiration gohard healthylifestyle healthychoices healthyfood youarewhatyoueat boxing calories keepingitreal realworkouts nutrition strength fat strengthtraining protein

90
14 minutes ago

LUNES Y NO DIETA! Creo que la pregunta que deberíamos hacernos es ¿PORQUE EL ÚNICO OBJETIVO QUE TENEMOS ES EL NÚMERO EN LA BALANZA? Es ahí donde cometemos el error. Se que es difícil desacostumbrarse a eso porque es algo que traemos de hace años pero en lo que deberíamos enfocarnos es en como nos sentimos, el nivel de energía, como rendimos, tener en cuenta las medidas corporales, guiarnos por la ropa, entre otras cosas. Si nos seguimos enfocando únicamente en el peso esta claro que vamos a frustrarnos, porque la constancia hace los cambios ;) APRENDER Y FORMAR NUEVOS HÁBITOS! Eso te propongo! BUEN COMIENZO DE SEMANA! TURNOS Y CONSULTAS: * WHATSAPP O MSJ DE TEXTO AL 2236334285 * Fb: Nutricionista Celeste Gutierrez Kraft lunes 2o18 food diet dieta nodieta hormonas fit fat food metabolic metabolismo salteocomida ayunoprolongado alimentacióninteligente healthy salud educaciónennutricion belleza salud alimentaciónconsciente educaciónennutrición nutrición GKNUTRITION

60
14 minutes ago

Fave. All the colours 🌈 Boxnutrition.co

102
14 minutes ago

have you ever just randomly started crying because you've been holding in all these emotions and pretending to be happy for way too long?

1326
15 minutes ago

Wow. What a feedback. This is a testimonial from one of our team member. What an amazing feedback from our Supernova and D-Lite product. How many of you believe in this, why not come and join our team to change your lifestyle and future. Do you want to lose weight? Do you want to look good and feel good? Who loves tea? Who loves coffee? Who loves shakes for meal replacement? DM to order yours today. Follow slimmingworld786 tslife launched teamwork opportunity weightlossresults weightlossjourney coffee tea resultsfitness cleanse organic babyweight detox results tea fat results halal cleanser weightlosssuccess weightlosstransformation shakes health nutritients supplement

61
20 minutes ago

Just ordered my skinnycoffeeclub and I'm very excited for it to arrive! I can't wait to get more fit😍 هاذي القهوئ تنحف و تحسين لياقة الجسم متحمسا اجربها 🤗

328
1 hour ago

131
2 hours ago

*competition time* Win £50 off your next treatment at Facethetics, all you have to do to be in with a chance of winning is: 1.Like this post 2.Follow us on Instagram 3.Tag as many friends as you like (however many people you tag will be how many times your name goes into the draw, get tagging for a higher chance of winning) And that’s not all, every person who enters the competition will receive £5 off their next treatment (only one per person) So even if you don’t win the big prize you are still receiving money off! So what are you waiting for?! Go go go! Strictly over 18 years of age only! Winner to be announced this Friday at 5pm! facethetics facetheticsmodels competition competitiontime everyonesawinner moneyoff botox filler dermalfiller lipfiller skinpeel dermaplaning microneedling cheekfiller jawfiller microsclerotherapy sunekos fat-reduction

184